DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT4G09160

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_192655.2 Gene:AT4G09160 / 826497 AraportID:AT4G09160 Length:668 Species:Arabidopsis thaliana


Alignment Length:267 Identity:56/267 - (20%)
Similarity:107/267 - (40%) Gaps:62/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QISQ--VKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRK 73
            |:||  .||||.        ..|...:|     .:|:.:.|.|:..||..::..:.|...|.||.
plant   317 QVSQDSSKTSIW--------GVPLLKDD-----RTDVVLLKFLRARDFKPQEAYSMLNKTLQWRI 368

  Fly    74 SFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLI----------LTIKKHSKSRNQEDLLRIL 128
            .|.:.::.:.||..:.  |..:::..:|::..|:..          |..|..|....:|..||..
plant   369 DFNIEELLDENLGDDL--DKVVFMQGQDKENHPVCYNVYGEFQNKDLYQKTFSDEEKRERFLRWR 431

  Fly   129 VFWIERLQRDSNLD----------KITIFMDMTGAGLSNLDMGFIKSIIGVFETKYP-YVPNYIL 182
            :.::|:..|  |||          ::....:..|.|.:.|.:. .|..:.:.:..|| :|...|.
plant   432 IQFLEKSIR--NLDFVAGGVSTICQVNDLKNSPGPGKTELRLA-TKQALHLLQDNYPEFVSKQIF 493

  Fly   183 VHDLPFLLDAAFKLVKTFLPP-------------EALKILKVTTKKDID-QY--VDKDNCLKIWG 231
            : ::|:...|.::::..|:..             .|..:||..:.:.:. ||  :..|||    .
plant   494 I-NVPWWYLAFYRIISPFMSQRSKSKLVFAGPSRSAETLLKYISPEHVPVQYGGLSVDNC----E 553

  Fly   232 GNDDYVY 238
            .|.|:.:
plant   554 CNSDFTH 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 33/177 (19%)
AT4G09160NP_192655.2 CRAL_TRIO_N 308..360 CDD:281722 14/55 (25%)
SEC14 383..547 CDD:238099 30/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.