DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SFH3

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001031389.1 Gene:SFH3 / 816693 AraportID:AT2G21540 Length:548 Species:Arabidopsis thaliana


Alignment Length:250 Identity:54/250 - (21%)
Similarity:104/250 - (41%) Gaps:62/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DSDLWITKLLQVYDFDVEKCITRLW-DNLAWRKSFGV------YDITEANLNQEFLNDGSIYVHN 99
            |....:.:.|:...||:||. .::| |.:.|||.|||      :|..|.:...::...|   .|.
plant    91 DDHHMMLRFLRARKFDLEKA-KQMWTDMIHWRKEFGVDTIMEDFDFKEIDEVLKYYPQG---YHG 151

  Fly   100 KDRDGKPLLILTIKK--HSKSRNQEDLLRILVFWIERLQRDSN-------------LDKITIFMD 149
            .|:||:|:.|..:.:  .:|......:.|.:.:.:...::..|             :|:.|..:|
plant   152 VDKDGRPVYIERLGQVDATKLMQVTTIDRYVKYHVREFEKTFNIKLPACSIAAKKHIDQSTTILD 216

  Fly   150 MTGAGLSNLDMG---FIKSIIGVFETKYPYVPNYILVHDLPFLLDA--AFKL----VKTFLPPEA 205
            :.|.||.:....   .::.|..:....||...|.:      |:::|  .|:|    ||:||.|:.
plant   217 VQGVGLKSFSKAARDLLQRIQKIDSDNYPETLNRM------FIINAGSGFRLLWSTVKSFLDPKT 275

  Fly   206 L------------KILKVTTKKDIDQYV-------DKDNCLKIWGG--NDDYVYK 239
            .            |:|::....::.:::       ||..|::...|  ||..::|
plant   276 TAKIHVLGNKYQSKLLEIIDSNELPEFLGGNCTCADKGGCMRSDKGPWNDPDIFK 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 35/185 (19%)
SFH3NP_001031389.1 CRAL_TRIO_N 71..117 CDD:215024 7/26 (27%)
SEC14 137..307 CDD:214706 32/178 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.