DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AT2G21520

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001118356.1 Gene:AT2G21520 / 816691 AraportID:AT2G21520 Length:637 Species:Arabidopsis thaliana


Alignment Length:273 Identity:59/273 - (21%)
Similarity:112/273 - (41%) Gaps:67/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QISQVKTSILQRLEKEPPAEPFHPNDL------KRITDSDLWITKLLQVYDFDVEKCITRLW-DN 68
            ::|.|....::.:|:....:.|..:.|      .|..|..:.: :.|:...|||||. .::| |.
plant    74 RVSSVSIEDVRDVEELQAVDAFRQSLLMDELLPDRHDDYHMML-RFLKARKFDVEKA-KQMWADM 136

  Fly    69 LAWRKSFGV------YDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQE--DLL 125
            :.|||.||.      :|..|.|   |.|.......|..|::|:|:.|..:.|...:|..:  .:.
plant   137 IQWRKEFGTDTIIQDFDFEEIN---EVLKHYPQCYHGVDKEGRPIYIERLGKVDPNRLMQVTSMD 198

  Fly   126 RILVFWIERLQRD-------------SNLDKITIFMDMTGAGLSNLDMG---FIKSIIGVFETKY 174
            |.:.:.::..:|.             .::|..|..:|:.|.||.|.:..   .|..:..:....|
plant   199 RYVRYHVKEFERSFMIKFPSCTISAKRHIDSSTTILDVQGVGLKNFNKSARDLITRLQKIDGDNY 263

  Fly   175 PYVPNYILVHDLPFLLDA--AFKL----VKTFLPPEA------------LKILKVTTKKDIDQYV 221
            |..     :|.: |:::|  .|:|    ||:||.|:.            .|:|:|....::.:::
plant   264 PET-----LHQM-FIINAGPGFRLLWNTVKSFLDPKTSAKIHVLGYKYLSKLLEVIDVNELPEFL 322

  Fly   222 -------DKDNCL 227
                   |:..|:
plant   323 GGACTCADQGGCM 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/179 (19%)
AT2G21520NP_001118356.1 CRAL_TRIO_N 90..136 CDD:215024 11/47 (23%)
SEC14 154..324 CDD:238099 36/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.