DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and TTPAL

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001034288.1 Gene:TTPAL / 79183 HGNCID:16114 Length:342 Species:Homo sapiens


Alignment Length:238 Identity:43/238 - (18%)
Similarity:93/238 - (39%) Gaps:53/238 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSDQDPTPEQISQVKTSILQRLEKEPPAEP-FHPNDLKRITD-------------SDLWITKLL 51
            :|...:| |..:..:...::.:..:|...:| :...|::.:.|             .|.::.:.|
Human    22 LPPPPEP-PGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPNLSTSLDDAFLLRFL 85

  Fly    52 QVYDFDVEKCITRLWDNLAWRKSF-GVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKH 115
            :...||.::.:..|.:..:.|:|: .|::..:.:..::.|..|               .||:..|
Human    86 RARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASG---------------FLTVLPH 135

  Fly   116 SKSRNQE-----------------DLLRILVFWIERL--QRDSNLDKITIFMDMTGAGLSNLD-M 160
            :..|...                 :.:|.:...:|:|  ..::.::.|.|..|..|..||... .
Human   136 TDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHF 200

  Fly   161 G-FI-KSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFL 201
            | || |.:||:.:..:|.....:.|.:.|.:....|.::|.||
Human   201 GPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIKPFL 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 27/132 (20%)
TTPALNP_001034288.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/9 (33%)
CRAL_TRIO_N 56..102 CDD:215024 7/45 (16%)
SEC14 121..277 CDD:238099 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.