DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and trappc4

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001136377.1 Gene:trappc4 / 779542 XenbaseID:XB-GENE-922036 Length:219 Species:Xenopus tropicalis


Alignment Length:200 Identity:38/200 - (19%)
Similarity:65/200 - (32%) Gaps:70/200 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ILQRLEKEPPAEPFH-----PNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVY 78
            ::.:|:.:.|.....     |.||            :|:|:|   |:.|.........:....|.
 Frog    15 LIYQLDNQSPRSESEKTFSFPLDL------------VLKVHD---ERVIVSFGQRDGIKVGHAVL 64

  Fly    79 DITEANLNQEFLNDGS---IYVHNKD------RDGKPLLILTIKKHSKSRNQEDLLRILVF---- 130
            .|...::|..:..||.   .|:.|..      |.|:|.|          .:.|.|:...:|    
 Frog    65 SINGIDVNGRYTADGKEILEYLGNPSNYPLSIRFGRPRL----------TSNEKLMLASMFHSLF 119

  Fly   131 -------------WIERLQRDSNLDKITIFMDMTG-----------AGLSNLDMGFIKSIIGVFE 171
                         .||.|:.|:  .|:..|..:||           ||:..| :..|..:...:.
 Frog   120 AIGSQLSPEPGSSGIEMLETDT--FKLHCFQTLTGIKFMVLSDPRQAGIDTL-LRKIYELYSDYA 181

  Fly   172 TKYPY 176
            .|.|:
 Frog   182 LKNPF 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 25/121 (21%)
trappc4NP_001136377.1 Sybindin 97..209 CDD:282019 21/102 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.