DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Mospd2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_011246175.1 Gene:Mospd2 / 76763 MGIID:1924013 Length:529 Species:Mus musculus


Alignment Length:238 Identity:77/238 - (32%)
Similarity:134/238 - (56%) Gaps:15/238 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKS 74
            |.::.|.:|.  .|||   :|.:...|::|:...|.|:...|......|::.:..|.::..|||.
Mouse    23 EYVTDVLSSF--PLEK---SEKYDSRDVERLQQDDNWVESYLYWRHNVVDETLKMLDESFQWRKE 82

  Fly    75 FGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQ-EDLLRILVFWIERLQRD 138
            |.|.|::|:::.:..|..|.||:|..|::|..|..:.:|.|.|.:.. .|..:::.||:||..:.
Mouse    83 FSVNDLSESSIPRWLLELGGIYLHGYDKEGNKLFWIRVKYHIKDQKTIMDKKKLIAFWLERYAKR 147

  Fly   139 SNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNY------ILVHDLPFLLDAAFKLV 197
            .|...||:..||:..||:::||.|::.||..|:.   |.|.|      |::.|:|::::||||:|
Mouse   148 ENGKPITVMFDMSETGLNSIDMDFVRFIINCFKV---YYPKYLCLSAKIVIFDMPWIMNAAFKIV 209

  Fly   198 KTFLPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            |::|.|||:.:||.|:|.:|.:||..:......||.|.:.|.:
Mouse   210 KSWLGPEAVSLLKFTSKNEIQEYVSVEYLPPHMGGTDPFKYSY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 52/147 (35%)
Mospd2XP_011246175.1 CRAL_TRIO 101..245 CDD:366224 52/146 (36%)
Motile_Sperm 338..442 CDD:334183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837798
Domainoid 1 1.000 114 1.000 Domainoid score I6066
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm42674
orthoMCL 1 0.900 - - OOG6_101230
Panther 1 1.100 - - O PTHR46384
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.