Sequence 1: | NP_001261456.1 | Gene: | CG32407 / 38667 | FlyBaseID: | FBgn0052407 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001342112.1 | Gene: | Clvs1 / 74438 | MGIID: | 1921688 | Length: | 354 | Species: | Mus musculus |
Alignment Length: | 245 | Identity: | 52/245 - (21%) |
---|---|---|---|
Similarity: | 97/245 - (39%) | Gaps: | 50/245 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PTPEQISQ-----VKTSILQ-----------RLEKEPPAEPFHPNDLKRITD------------- 42
Fly 43 SDLWITKLLQVYDF---DVEKCITRLWD----NLAWRKSFGVYDITEANLNQEFLNDGSIYVHNK 100
Fly 101 DRDGKPLLILTIKKHSKSRNQ-EDLLRILVFWIERLQRDSNL--DKITIFMDMTGAGL---SNLD 159
Fly 160 MGFIKSIIGVFETKYPYVPNYILVH--DLPFLLDAAFKLVKTFLPPEALK 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32407 | NP_001261456.1 | CRAL_TRIO | 92..233 | CDD:279044 | 30/124 (24%) |
Clvs1 | NP_001342112.1 | CRAL_TRIO_N | 51..97 | CDD:215024 | 7/45 (16%) |
CRAL_TRIO | 125..274 | CDD:366224 | 30/124 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 317..354 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |