DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_083053.2 Gene:Sec14l1 / 74136 MGIID:1921386 Length:719 Species:Mus musculus


Alignment Length:224 Identity:57/224 - (25%)
Similarity:92/224 - (41%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEFLNDGSIYV---HNKDRDGK 105
            |..|.:.|:..||:::|....:..:|.|||...|..|.:.....:.|.|  .|.   |:.|:||:
Mouse   277 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLLD--YYAGGWHHHDKDGR 339

  Fly   106 PLLILTI-----KKHSKSRNQEDLLR-ILVFWIERLQRDSNLDKI--------TIFMDMTGAGLS 156
            ||.:|.:     |...::..:|.||| :|....|.|:|.....|:        |..:|:.|..:.
Mouse   340 PLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMR 404

  Fly   157 NLDMGFIKS---IIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDID 218
            :|....:|:   ||.|.|..||.....:|:...|.:....:.||..|:...       |.:|.: 
Mouse   405 HLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDN-------TRRKFL- 461

  Fly   219 QYVDKDNCLKIWGGND--------DYVYK 239
                      |:.|||        ||:.|
Mouse   462 ----------IYAGNDYQGPGGLLDYIDK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 38/160 (24%)
Sec14l1NP_083053.2 Required for interaction and inhibitory function toward DDX58. /evidence=ECO:0000250|UniProtKB:Q92503 1..510 57/224 (25%)
PRELI 17..173 CDD:282550
CRAL_TRIO_N 256..301 CDD:215024 6/23 (26%)
CRAL_TRIO 326..490 CDD:279044 43/173 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.