DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SEC14L6

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 / 730005 HGNCID:40047 Length:432 Species:Homo sapiens


Alignment Length:284 Identity:59/284 - (20%)
Similarity:106/284 - (37%) Gaps:70/284 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQ-ISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWD 67
            |..|:.|: ::|.:.:|...|...|     :|:        |.::.:.||...||::|....|..
Human    10 DLSPSQEKSLAQFRENIQDVLSALP-----NPD--------DYFLLRWLQARSFDLQKSEDMLRK 61

  Fly    68 NLAWRKSFGVYDITEANLNQ--EFLNDGSIYVHNKDRDGKPL------------LILTIKKHSKS 118
            ::.:||...:.:|......:  ...|...|..|  |.:|.|:            |:|:..|....
Human    62 HMEFRKQQDLANILAWQPPEVVRLYNANGICGH--DGEGSPVWYHIVGSLDPKGLLLSASKQELL 124

  Fly   119 RNQ----EDLLRILVFWIER------------LQRDSN------------------LDKITIFMD 149
            |:.    |.|||......::            |.|..|                  ::||.....
Human   125 RDSFRSCELLLRECELQSQKPHWTRGTGISAPLDRRGNCNTAIWPPMDRHKELGKRVEKIIAIFG 189

  Fly   150 MTGAGLSNL---DMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALK---I 208
            :.|.||.:|   .:..::......|..||.:...::|...|.|...||.|||:::..|..:   |
Human   190 LEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKSYMSEETRRKVVI 254

  Fly   209 LKVTTKKDIDQYVDKDNCLKIWGG 232
            |....|:::.:::..|.....:||
Human   255 LGDNWKQELTKFISPDQLPVEFGG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 40/193 (21%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.