DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and RLBP1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_016877949.1 Gene:RLBP1 / 6017 HGNCID:10024 Length:326 Species:Homo sapiens


Alignment Length:120 Identity:21/120 - (17%)
Similarity:56/120 - (46%) Gaps:16/120 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NKDRDGKPLLILTIKK-HSKSRNQEDLLRILVFWIERL--QRDSNLDKITIFMDMTG------AG 154
            ::|:.|:.:::..|:. .|:....:::|:...|.:|:|  ..::.::...|..:..|      |.
Human   159 SRDKYGRVVMLFNIENWQSQEITFDEILQAYCFILEKLLENEETQINGFCIIENFKGFTMQQAAS 223

  Fly   155 LSNLDMGFIKSIIGVFETKYPYVPNYILVHDL--PFLLDAAFKLVKTFLPPEALK 207
            |...|   ::.::.:.:..:|  ..:..:|.:  |:.....:.:||.||..:.|:
Human   224 LRTSD---LRKMVDMLQDSFP--ARFKAIHFIHQPWYFTTTYNVVKPFLKSKLLE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 21/120 (18%)
RLBP1XP_016877949.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.