powered by:
Protein Alignment CG32407 and Vapa
DIOPT Version :9
Sequence 1: | NP_001261456.1 |
Gene: | CG32407 / 38667 |
FlyBaseID: | FBgn0052407 |
Length: | 241 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_008765606.1 |
Gene: | Vapa / 58857 |
RGDID: | 61803 |
Length: | 290 |
Species: | Rattus norvegicus |
Alignment Length: | 54 |
Identity: | 12/54 - (22%) |
Similarity: | 27/54 - (50%) |
Gaps: | 8/54 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 QDPTPEQIS-QVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFD 57
|:|:..::. :|||:..:|....|.:....|..: :.::.:||.:|:|
Rat 40 QNPSDRKVCFKVKTTAPRRYCVRPNSGVIDPGSI-------VTVSVMLQPFDYD 86
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG32407 | NP_001261456.1 |
CRAL_TRIO |
92..233 |
CDD:279044 |
|
Vapa | XP_008765606.1 |
Motile_Sperm |
14..118 |
CDD:279029 |
12/54 (22%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.