DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and clvs2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001020716.1 Gene:clvs2 / 566769 ZFINID:ZDB-GENE-041014-313 Length:329 Species:Danio rerio


Alignment Length:244 Identity:53/244 - (21%)
Similarity:95/244 - (38%) Gaps:40/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITD-------------SDLWITKLLQVYDFDVE 59
            :||.:.:.|..:     ||.| :..| .|::.:.|             .|.:|.:.|:...|:..
Zfish     9 SPETLEKAKVEL-----KENP-DTLH-QDIQEVRDMIITRPDIGFLRTDDAFILRFLRARKFNHF 66

  Fly    60 KCITRLWDNLAWRKS----FGVYDITEANLNQEFLNDGSIYV-HNKDRDGKPLLILTIKKHSKSR 119
            :....|.....:|:.    |.....|:..:.|. |.||...| .|.||.|:.:|:|......:||
Zfish    67 EAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQA-LKDGFPGVLSNLDRYGRKILVLFAANWDQSR 130

  Fly   120 -NQEDLLRILVFWIERLQRDSNLD-----KITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVP 178
             ...|:||.::..:|.:..|..|.     .|..:.:.|....|.|....::..|...:..:|...
Zfish   131 YTFVDILRAILLSLEAMIEDPELQVNGFVLIIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARF 195

  Fly   179 NYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDIDQYVDKDNCL 227
            ..|...:.|:.:.|.:.:::.|        ||..|:|.|..:.:..|.|
Zfish   196 GGIHFVNQPWYIHALYTVIRPF--------LKDKTRKRIFMHGNNLNSL 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 34/143 (24%)
clvs2NP_001020716.1 CRAL_TRIO_N 29..75 CDD:215024 7/45 (16%)
SEC14 106..251 CDD:238099 32/139 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..329
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.