DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP007355

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_001687952.1 Gene:AgaP_AGAP007355 / 5667212 VectorBaseID:AGAP007355 Length:319 Species:Anopheles gambiae


Alignment Length:240 Identity:46/240 - (19%)
Similarity:85/240 - (35%) Gaps:62/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEFLNDGSIY----- 96
            |.|....|.::.:.|:|..|.|......|...|..|::   |....|.|:.|..:.|::.     
Mosquito    50 LHRCRTDDRFLLRFLRVKKFSVPMACEMLERYLTMRQT---YPRWFARLDPEDADLGAVLDACCL 111

  Fly    97 --VHNKDRDGKPLLILTIKKHSKSR-NQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAG---- 154
              :......|:.::...::.....| |.:.::|:.:...|.| .|...::|..|..:...|    
Mosquito   112 VPIGRDPASGRIVIFGVVRNFDAQRYNSDTMIRLNMLVAEAL-LDEEANQIAGFTHIFDNGGMTM 175

  Fly   155 -------LSNLDMGFIKSIIG-----VFETKYPYVPNYIL-----------------VHDLPFLL 190
                   |.|| .|:::|:|.     :.|..:..||.:..                 :|....:.
Mosquito   176 AHVTCWTLDNL-AGYLRSVINCVPVRLKENHFVSVPTFAAQISKYCLSFASEKLRARIHCHSTVE 239

  Fly   191 DAAFKLVKTFLPPE------ALKIL----------KVTTKKDIDQ 219
            :...|:....||.|      .||:|          |.||..::|:
Mosquito   240 ELRAKVSPELLPLEYGGNGATLKVLNERFREFLRSKRTTLLELDE 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 32/185 (17%)
AgaP_AGAP007355XP_001687952.1 CRAL_TRIO_N 34..81 CDD:215024 8/30 (27%)
CRAL_TRIO 110..257 CDD:279044 24/148 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.