DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP005385

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_001688654.1 Gene:AgaP_AGAP005385 / 5667138 VectorBaseID:AGAP005385 Length:326 Species:Anopheles gambiae


Alignment Length:272 Identity:59/272 - (21%)
Similarity:107/272 - (39%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSDQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDL---KRITDSDLWIT-------------- 48
            :|...|..|::..:.|.: |..|.:|...|....:||   |.:|:...||.              
Mosquito     6 LPFAVDKCPKEYDEYKFT-LPALYREVAKEELREDDLVLVKALTEMRHWIAENPYIFKCRTDAKF 69

  Fly    49 --KLLQVYDFDVEKCITRLWDNLAWRKSF-GVYDITEAN--LNQEFLNDGSIYVHNKDRDGKPLL 108
              :.|:...|.|......|...|..|:.: |.:...:.|  :.||.|:........:|..|:...
Mosquito    70 LLRFLRFRQFSVPMACEALERYLTVRELYPGWFKKLDCNDPIMQEILDYEPFTYIGQDSAGRAAF 134

  Fly   109 IL-----TIKKHSKSRNQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAGLSNLD---MGFIKS 165
            ::     .|:|||.|::...:..||...:|  ..:..:....:|:|..|..:.:.|   ...:|.
Mosquito   135 LIRFGRFNIEKHSPSQDARYMALILETVLE--WEEFQIGSCQVFVDYRGCTVGHFDKWSTSELKI 197

  Fly   166 IIGVFETKYPYVPNYILVH--DLPFLLDAAFKLVKTFL----PPEALKILKVTTKKDIDQYVDKD 224
            ::.||...||.  .|..:|  .||   ..|..:::|||    |....||....|.:::::.::..
Mosquito   198 MMDVFSRSYPL--RYGEIHGAKLP---KQAVPIIETFLSFANPKLREKINCYPTIEELEKRLEPA 257

  Fly   225 NCLKIWGGNDDY 236
            .....:||..|:
Mosquito   258 CKPTTYGGTVDF 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 32/154 (21%)
AgaP_AGAP005385XP_001688654.1 CRAL_TRIO_N 45..91 CDD:215024 8/45 (18%)
CRAL_TRIO 118..266 CDD:279044 32/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.