DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Ttpa

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_056582.1 Gene:Ttpa / 50500 MGIID:1354168 Length:278 Species:Mus musculus


Alignment Length:177 Identity:37/177 - (20%)
Similarity:71/177 - (40%) Gaps:28/177 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SDLWITKLLQVYDFDVEKCITRLWDNLAWR--KSFGVYDITEANLNQEFLNDGSI---------- 95
            :|.::.:.|:..|||::         ||||  |::..:......|:.: |...||          
Mouse    48 TDAFLLRFLRARDFDLD---------LAWRLMKNYYKWRAECPELSAD-LRPRSILGLLKAGYHG 102

  Fly    96 YVHNKDRDGKPLLILTIKK-HSKSRNQEDLLRILVFWIERLQRDSNLDK--ITIFMDMTGAGLSN 157
            .:.::|..|..:||..|.. ..|.....|:.|:.:...|.:.::....:  :....|:.|..:|:
Mouse   103 VLRSRDSTGSRVLIYRIAYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQVSH 167

  Fly   158 ---LDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFL 201
               :.....|.|..|....:|.....|.:.:.|.:..|.|.::|.||
Mouse   168 AFQITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 25/126 (20%)
TtpaNP_056582.1 CRAL_TRIO_N 25..73 CDD:215024 10/33 (30%)
CRAL_TRIO 99..248 CDD:279044 23/116 (20%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W67 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000269|PubMed:23599266, ECO:0007744|PDB:3W68 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.