DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and mospd2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001008142.1 Gene:mospd2 / 493504 XenbaseID:XB-GENE-957659 Length:509 Species:Xenopus tropicalis


Alignment Length:237 Identity:69/237 - (29%)
Similarity:129/237 - (54%) Gaps:8/237 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ISQVKTSILQRLEK-------EPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNL 69
            :::.|..::|...|       :..|:.:...|::|:...|..:...|....:..|:.:..:.::|
 Frog     1 MAEDKEQLIQETRKRFTQEYLQDKADRYDSRDVERLQKDDTLVESYLMWRHYVTEEALKMMDESL 65

  Fly    70 AWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSK-SRNQEDLLRILVFWIE 133
            .|||..||.|:.|:.:.:.....|:.|:|..|::|..||.|.:|.|.: .:..||..:.:.||:|
 Frog    66 KWRKDIGVNDLNESTIPKWCFETGASYLHGYDKEGNKLLWLKVKLHVRDGKTTEDKKKFVAFWLE 130

  Fly   134 RLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVK 198
            |..|......||:..||..:||||:||.|::.::..|:|.||...:.::::::|::|:||||:||
 Frog   131 RYARREPGKFITVVFDMVDSGLSNVDMDFVRFVVNSFKTYYPRYLSKMVIYEMPWILNAAFKIVK 195

  Fly   199 TFLPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            ::|.|||:.:||...|..:..|:..:......||.|.:.|.:
 Frog   196 SWLGPEAISLLKFANKNQVQDYISAEYLPPHMGGTDPFKYSY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 49/141 (35%)
mospd2NP_001008142.1 CRAL_TRIO 88..230 CDD:366224 49/141 (35%)
Motile_Sperm 315..419 CDD:334183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm47773
Panther 1 1.100 - - O PTHR46384
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.140

Return to query results.
Submit another query.