DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and mospd2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001007294.2 Gene:mospd2 / 492327 ZFINID:ZDB-GENE-041114-1 Length:526 Species:Danio rerio


Alignment Length:242 Identity:72/242 - (29%)
Similarity:133/242 - (54%) Gaps:7/242 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SDQD---PTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITR 64
            |:||   ...|...:.|:..::..|.:   |.:...|::::...|..:...|....|.||..:..
Zfish     9 SEQDIEIKIQETRQRFKSEYVEAQESQ---EKYDSRDVEKLFRDDALVEGYLTWRHFIVEDTLKM 70

  Fly    65 LWDNLAWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKS-RNQEDLLRIL 128
            :.::|.||:.|.|.|:||:::.:.....|::|:|..|::|..|....:|.|.|. :...|..|.:
Zfish    71 IDESLQWRREFSVNDLTESSIPRWMFEIGAVYLHGYDKEGNKLFWFKVKLHIKDPKTVLDKKRYV 135

  Fly   129 VFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAA 193
            .||:||..:......:|:..||:.:||||:||.|:|.||..|:..||...:.::::::|::::||
Zfish   136 AFWLERYAKREPGMPLTVVFDMSESGLSNIDMDFVKYIISCFKVYYPKFLSKMIMYEMPWIMNAA 200

  Fly   194 FKLVKTFLPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            :|:|||:|.|:|:..||..:|.||..:|..::.....||.|.:.|.:
Zfish   201 WKIVKTWLGPDAISKLKFVSKSDIQTFVGPEHLPPYMGGTDQFKYSY 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 48/141 (34%)
mospd2NP_001007294.2 CRAL_TRIO 99..240 CDD:279044 48/140 (34%)
Motile_Sperm 333..437 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581551
Domainoid 1 1.000 114 1.000 Domainoid score I6035
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm26349
orthoMCL 1 0.900 - - OOG6_101230
Panther 1 1.100 - - O PTHR46384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.