DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and vapal

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001002546.1 Gene:vapal / 436819 ZFINID:ZDB-GENE-040718-281 Length:246 Species:Danio rerio


Alignment Length:169 Identity:35/169 - (20%)
Similarity:69/169 - (40%) Gaps:46/169 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QDPTPEQIS-QVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDV-EKC------ 61
            ::|:..::. :|||:..:|....|.:....|.       :.|.|:.:||.:|:|. ||.      
Zfish    33 KNPSERKVCFKVKTTAPRRYCVRPNSGIIDPG-------ATLTISVMLQPFDYDPNEKSKHKFMV 90

  Fly    62 -----------ITRLW-----DNLAWRKSFGVYDITEAN--LNQEFLNDGSIYV---HNKDRDGK 105
                       ...:|     |.|...|...|:::...|  :|:.   |.:..|   ::...|| 
Zfish    91 QTIFAPPAVSDTEAMWKDAKPDELMDSKLRCVFELPSENDKVNEV---DSACKVPVLNSSKADG- 151

  Fly   106 PLLILTIKKHSKSRNQEDLLRILVFWIERLQRDSNLDKI 144
               :|::|..|.:.:..::.|||.   :|.:..:.|.|:
Zfish   152 ---LLSVKPLSGAHDDSEMRRILE---DRKRLQTELSKL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 13/56 (23%)
vapalNP_001002546.1 Motile_Sperm 7..111 CDD:279029 16/84 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.