DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG10300

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_651174.2 Gene:CG10300 / 42798 FlyBaseID:FBgn0039107 Length:311 Species:Drosophila melanogaster


Alignment Length:266 Identity:57/266 - (21%)
Similarity:89/266 - (33%) Gaps:67/266 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            :|....|.|:.:||.|    .|.|        .||..||..| |...|:...|..|:...|..:.
  Fly    23 EQAQRAEIIATIKTWI----TKSP--------HLKAPTDEQL-ILAFLRRCRFSQEETKRRFDNY 74

  Fly    69 LAWRKSF----GVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKK-HSKSRNQEDLLRIL 128
            .:.|..|    |...:.||.|.|.......|.:.....:|..::|...:. ..|..|..:..:::
  Fly    75 YSLRSVFPEVLGSRQVDEALLTQLQRGIHVIPMRPVSPEGPRVIISQFRNIDPKKSNPREAFKLI 139

  Fly   129 VFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAA 193
            ...:|.|..:                   .|...|..:|.|.:.: ......::.:| ||||..|
  Fly   140 FIMLELLALE-------------------CDNAAISGLIWVVDAR-DVTMEQMMQYD-PFLLKKA 183

  Fly   194 FKLVKTFLP--------------------------PEALKILKVTTKK--DIDQYVDKDNCLKIW 230
            |.||...:|                          |..|....|..||  |:.|::.:|.....:
  Fly   184 FALVDQCIPLRFVEIHMINMRKEGQTIFNFVTKFLPSKLPFKFVVHKKSEDLYQHLPRDVMTIEY 248

  Fly   231 GGNDDY 236
            ||.:.|
  Fly   249 GGTNGY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/169 (18%)
CG10300NP_651174.2 SEC14 95..251 CDD:238099 32/176 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.