DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG10657

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_648579.3 Gene:CG10657 / 39423 FlyBaseID:FBgn0036289 Length:334 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:84/211 - (39%) Gaps:38/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVY----DITEANLNQEFLNDG 93
            ||:..|..||: :::.:.|:...|.|......|...|..|:.|..:    ||.:..:|:.|.|..
  Fly    64 HPHIRKCRTDT-VFLLRFLRTKKFSVPSACEMLERYLTIRQLFPQWFKQLDINDPAINEIFENGY 127

  Fly    94 SIYVHNKDRDGKPLLILTIKKHSKSR-NQEDLLRILVFWIERL--QRDSNLDKITIFMDMTGAGL 155
            .:.:..:|..|:.::.....|....: ....:.|:.....|.|  ..||.:.......|.:|   
  Fly   128 LVPLPQRDSTGRQVIFSVAAKFDPYKFTSVQMARVHSLVCEALLDDEDSQVAGYVYINDESG--- 189

  Fly   156 SNLDMGFI--------KSIIGVF---------ETKYPYVPNY---ILVHDLPFLLDAAFKLVKTF 200
              ::|||:        :||:...         ||.:..:|:|   |:...:..|.|   ||.|..
  Fly   190 --MNMGFVSLWSLTDLRSIVKCIQNSTPMRHKETHFVNIPHYANRIIELGVSMLSD---KLKKRI 249

  Fly   201 LPPEALKILKVTTKKD 216
            :..:.:.|||  ||.|
  Fly   250 IVHKNVDILK--TKID 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 31/148 (21%)
CG10657NP_648579.3 CRAL_TRIO_N 52..98 CDD:215024 9/34 (26%)
CRAL_TRIO 126..274 CDD:279044 31/148 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.