DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG6527

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001287021.1 Gene:CG6527 / 39197 FlyBaseID:FBgn0036085 Length:166 Species:Drosophila melanogaster


Alignment Length:125 Identity:25/125 - (20%)
Similarity:44/125 - (35%) Gaps:36/125 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAWRKSFGVYDITEANLNQEFLNDGSIY-----VHNK-----------DRDGKPLLILTIKKHSK 117
            |.:.|:...::||..|:.::.:.    |     ||.|           ..:...:||...|....
  Fly    16 LTFTKTNNKHEITIKNVGEKTVT----YKVQCTVHGKFNIKPRWGVLSPNEHSHVLITMCKDVEL 76

  Fly   118 SRNQEDLLRILV---------------FWIERLQRDSNLDKITIFM-DMTGAGLSNLDMG 161
            ||...|.:.::.               ||...:..|.:::|..:.. .|.|||..:.|.|
  Fly    77 SRKGRDKIVVVCMVSPINAVDFEMTASFWRHNICYDPSIEKHQLTCHQMDGAGEGHGDGG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 20/102 (20%)
CG6527NP_001287021.1 Motile_Sperm 8..110 CDD:279029 17/97 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.