DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG33523

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001261457.1 Gene:CG33523 / 38668 FlyBaseID:FBgn0053523 Length:654 Species:Drosophila melanogaster


Alignment Length:236 Identity:113/236 - (47%)
Similarity:173/236 - (73%) Gaps:0/236 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNL 69
            ::.||:||.:::....::....|||.||||.|:.||.:..||:.:.|::||.|:|.....||:..
  Fly     6 KETTPQQIEELRDRFNRKYASSPPAAPFHPTDIDRIRNDHLWLQRFLEMYDLDMETSFNSLWETC 70

  Fly    70 AWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLLRILVFWIER 134
            ..|:|.|..||.|:.||||:|.:||::|||.|.||||||:..:|.||||:|.::|:||:|:|:||
  Fly    71 ILRQSTGANDIDESELNQEYLKEGSVFVHNTDVDGKPLLVFRVKMHSKSKNLDELIRIVVYWVER 135

  Fly   135 LQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKT 199
            .||:.:|.::|||.||:|..|:::|:.|:|.|:..|:..||...|||||::|.::|:||||::|.
  Fly   136 TQREQHLTQLTIFFDMSGTSLASMDLEFVKRIVETFKQFYPNSLNYILVYELGWVLNAAFKVIKA 200

  Fly   200 FLPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            .|||:|::|||:.:||||:||::|||||.||||.|:|.:.|
  Fly   201 VLPPKAVEILKMISKKDINQYINKDNCLAIWGGEDNYEFSF 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 75/140 (54%)
CG33523NP_001261457.1 CRAL_TRIO 94..234 CDD:279044 75/139 (54%)
Motile_Sperm 293..396 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449908
Domainoid 1 1.000 114 1.000 Domainoid score I6035
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm26349
orthoMCL 1 0.900 - - OOG6_101230
Panther 1 1.100 - - P PTHR46384
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
109.780

Return to query results.
Submit another query.