DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Sec14l3

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001025108.1 Gene:Sec14l3 / 380683 MGIID:3617848 Length:401 Species:Mus musculus


Alignment Length:276 Identity:60/276 - (21%)
Similarity:115/276 - (41%) Gaps:68/276 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLA 70
            |.:|:| ::......:.::...||.| :|:        |.::.:.|:..:||::|....|...:.
Mouse     7 DLSPKQ-AETLAKFRENVQDVLPALP-NPD--------DYFLLRWLRARNFDLQKSEAMLRKYME 61

  Fly    71 WRKSFGVYDITE---ANLNQEFLNDGSIYVHNKDRDGKPL------------LILTIKKH----S 116
            :||:..:..|.:   ..:.|:::..|   :...||||.|:            |:.::.|.    :
Mouse    62 FRKTMDIDHILDWQPPEVIQKYMPGG---LCGYDRDGCPVWYDIIGPLDPKGLLFSVTKQDLLKT 123

  Fly   117 KSRNQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSII-------GVFETKY 174
            |.|:.|.:|.......|||.|  .::.|.:..|..|.||.:    |.|.::       |:.|..|
Mouse   124 KMRDCERILHECDLQTERLGR--KIETIVMIFDCEGLGLKH----FWKPLVEVYQEFFGLLEENY 182

  Fly   175 PYVPNYILVHDLPFLLDAAFKLVKTFLPPEALK-------------ILKVTTKKDIDQY-----V 221
            |....::|:.....|....:.|:|.||..:..:             :||:.:.:::..:     .
Mouse   183 PETLKFMLIVKATKLFPVGYNLMKPFLSEDTRRKIVVLGSNSWKEGLLKLISPEELPAHFGGTLT 247

  Fly   222 DKD---NCL-KI-WGG 232
            |.|   .|| || :||
Mouse   248 DPDGNPKCLTKINYGG 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 43/187 (23%)
Sec14l3NP_001025108.1 CRAL_TRIO_N 13..59 CDD:215024 10/54 (19%)
SEC14 76..246 CDD:214706 36/178 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.