DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Clvs1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001102439.1 Gene:Clvs1 / 366311 RGDID:1564200 Length:354 Species:Rattus norvegicus


Alignment Length:245 Identity:53/245 - (21%)
Similarity:96/245 - (39%) Gaps:50/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTPEQISQ-----VKTSILQ-----------RLEKEPPAEPFHPNDLKRITD------------- 42
            |.|:.||.     .|.:.||           |||.....:..| .|::::.|             
  Rat     8 PKPQSISTWEGDLAKMTHLQAGLSPDTIEKARLELNENPDVLH-QDIQQVRDMIITRPDIGFLRT 71

  Fly    43 SDLWITKLLQVYDF---DVEKCITRLWD----NLAWRKSFGVYDITEANLNQEFLNDGSIYVHNK 100
            .|.:|.:.|:...|   |..:.:.:.:.    ||...|:|...|   ..:.:..::.....:.|:
  Rat    72 DDAFILRFLRARKFHQADAFRLLAQYFQYRQLNLDMFKNFKADD---PGIKRALIDGFPGVLENR 133

  Fly   101 DRDGKPLLILTIKKHSKSRNQ-EDLLRILVFWIERLQRDSNL--DKITIFMDMTGAGL---SNLD 159
            |..|:.:|:|......:|||. .|:||.::..:|.|..|..|  :...:.:|.:....   |.|.
  Rat   134 DHYGRKILLLFAANWDQSRNSFTDILRAILLSLEVLIEDPELQINGFILIIDWSNFSFKQASKLT 198

  Fly   160 MGFIKSIIGVFETKYPYVPNYILVH--DLPFLLDAAFKLVKTFLPPEALK 207
            ...:|..|...:..:|  ..:..||  :.|:.:.|.:.|:|.||..:..|
  Rat   199 PSILKLAIEGLQDSFP--ARFGGVHFVNQPWYIHALYTLIKPFLKDKTRK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/124 (24%)
Clvs1NP_001102439.1 CRAL_TRIO_N 51..97 CDD:215024 7/45 (16%)
CRAL_TRIO 125..274 CDD:395525 30/124 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..354
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.