DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Mospd2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_006256927.1 Gene:Mospd2 / 363463 RGDID:1563952 Length:518 Species:Rattus norvegicus


Alignment Length:239 Identity:76/239 - (31%)
Similarity:135/239 - (56%) Gaps:8/239 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EQISQVKTSIL----QRLEKE---PPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWD 67
            |..:|.|..::    :|.|.|   ..:|.:.|.|::|:...|.|:...|......|::.:..|.:
  Rat     3 ENNAQNKAKLISETRRRFEAEYVTEKSEKYDPRDVERLQQDDNWVESYLHWRHNVVDETLKMLDE 67

  Fly    68 NLAWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQ-EDLLRILVFW 131
            :..|||...|.|::|:::.:..|..|.||:|..|::|..|..:.:|.|.|.:.. .|..:::.||
  Rat    68 SFQWRKELSVNDLSESSIPRWLLELGGIYLHGYDKEGNKLFWIRVKYHIKDQKTIMDKKKLIAFW 132

  Fly   132 IERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKL 196
            :||..:..|...||:..||:..||:::||.|::.||..|:..||...:.|::.|:|::::||||:
  Rat   133 LERYAKRENGKPITVMFDMSETGLNSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWIMNAAFKI 197

  Fly   197 VKTFLPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            ||::|.|||:.:||.|:|.:|.:||..:......||.|.:.|.:
  Rat   198 VKSWLGPEAVSLLKFTSKNEIQEYVSVEYLPPHMGGTDPFKYSY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 51/141 (36%)
Mospd2XP_006256927.1 CRAL_TRIO 93..234 CDD:279044 51/140 (36%)
Motile_Sperm 327..431 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341546
Domainoid 1 1.000 114 1.000 Domainoid score I5914
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm44739
orthoMCL 1 0.900 - - OOG6_101230
Panther 1 1.100 - - O PTHR46384
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.