DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Sec14l1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001101779.1 Gene:Sec14l1 / 360668 RGDID:1563123 Length:720 Species:Rattus norvegicus


Alignment Length:224 Identity:57/224 - (25%)
Similarity:92/224 - (41%) Gaps:48/224 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEFLNDGSIYV---HNKDRDGK 105
            |..|.:.|:..||:::|....:..:|.|||...|..|.:.....:.|.|  .|.   |:.|:||:
  Rat   278 DEHILRFLRARDFNIDKAREIMCQSLTWRKQHQVDYILDTWTPPQVLQD--YYAGGWHHHDKDGR 340

  Fly   106 PLLILTI-----KKHSKSRNQEDLLR-ILVFWIERLQRDSNLDKI--------TIFMDMTGAGLS 156
            ||.:|.:     |...::..:|.||| :|....|.|:|.....|:        |..:|:.|..:.
  Rat   341 PLYVLRLGQMDTKGLVRALGEEALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMR 405

  Fly   157 NLDMGFIKS---IIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKDID 218
            :|....:|:   ||.|.|..||.....:|:...|.:....:.||..|:...       |.:|.: 
  Rat   406 HLWRPGVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDN-------TRRKFL- 462

  Fly   219 QYVDKDNCLKIWGGND--------DYVYK 239
                      |:.|||        ||:.|
  Rat   463 ----------IYAGNDYQGPGGLLDYIDK 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 38/160 (24%)
Sec14l1NP_001101779.1 PRELI 17..173 CDD:282550
CRAL_TRIO_N 257..302 CDD:215024 6/23 (26%)
CRAL_TRIO 327..491 CDD:279044 43/173 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.