DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG10237

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_609967.1 Gene:CG10237 / 35222 FlyBaseID:FBgn0032783 Length:324 Species:Drosophila melanogaster


Alignment Length:276 Identity:56/276 - (20%)
Similarity:109/276 - (39%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSDQDPTP--------------EQISQVKTSILQRLEKEPPAEPFHPNDLKRI--TDSDL---- 45
            |.||.|..|              |..:|.|...::.|.:.|..:.....:|.|:  .::||    
  Fly    24 MLSDIDQLPTLQVGDYTLQFELGEPTAQGKEVAIKELRETPERQKEASKELARLLEAETDLLYPK 88

  Fly    46 ----WITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEF--LNDGSIYVH------ 98
                |:.:.|:...:..|.....:       |.:..:.:..|::..:.  .|:.:|:.|      
  Fly    89 GNEEWLIRYLRPCKYYPESARDLI-------KRYYAFKVKHADVYTDLKPSNEANIFKHNILTVF 146

  Fly    99 -NKDRDGKPLLILTIKKHSKSR--NQEDLLRILVFWIE--RLQRDSNLDKITIFMDMTGAGLS-- 156
             |:|:.|:.:|:|.:.|..|.:  ..:::.:..|.::|  .|:.::.:....:..||.|..|.  
  Fly   147 PNRDQLGRRILVLELGKRWKHKQVTLDEVFKGAVLFLEAAMLEPETQICGAVVIFDMDGLSLQQT 211

  Fly   157 -NLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALK---ILKVTTKKDI 217
             .....|.|.|:...:...|.....|.:.:.|.:....|.|.|.|| .|.|:   |...|.::.:
  Fly   212 WQFTPPFAKRIVDWLQDSVPLRIKAIHIVNQPKIFQVVFALFKPFL-KEKLRSRIIFHGTDRESL 275

  Fly   218 DQYVDKDNCL-KIWGG 232
            .:|: ...|| ..:||
  Fly   276 HKYM-SPKCLPAAYGG 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 36/159 (23%)
CG10237NP_609967.1 CRAL_TRIO_N 68..115 CDD:215024 8/53 (15%)
SEC14 137..290 CDD:238099 34/154 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.