DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Ku80

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_609767.2 Gene:Ku80 / 34930 FlyBaseID:FBgn0041627 Length:699 Species:Drosophila melanogaster


Alignment Length:154 Identity:28/154 - (18%)
Similarity:54/154 - (35%) Gaps:52/154 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GKPLLILTIKKHSKSR--NQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSI 166
            |:.|.:|..:||::|.  ..:.|:|.||          :.|:..:...                 
  Fly   329 GESLYLLVHQKHNQSAAVKLDALVRALV----------SSDRAILCWK----------------- 366

  Fly   167 IGVFETKYPYVPNYILVHDLP--------FLLDAAFKLVKTFLPPEALKILKVTTKKD----IDQ 219
              ::.||:......:|:..|.        ::|:.::.....|....||:..|....::    |||
  Fly   367 --IYSTKFNRPQMVVLLPRLADDTHPATLYMLEVSYTSQHHFWDFPALRTTKTECSEEQLNAIDQ 429

  Fly   220 YVDKDN--CL-------KIWGGND 234
            .:|..:  |.       :.|..||
  Fly   430 LIDSTDLECTLRDTQQPRPWAQND 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 26/151 (17%)
Ku80NP_609767.2 Ku_N 7..213 CDD:281693
KU80 221..524 CDD:238445 28/154 (18%)
Ku_PK_bind 562..663 CDD:285938
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.