DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG5973

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001162901.1 Gene:CG5973 / 34023 FlyBaseID:FBgn0031914 Length:311 Species:Drosophila melanogaster


Alignment Length:183 Identity:35/183 - (19%)
Similarity:69/183 - (37%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DLWITKLLQVYDFDVEKCITRLWDNLAWRKSFG----------VYDITEANLNQEFLNDGSIYVH 98
            |.::...|:...:..|..:.||.:....:..:|          :.::.|||:    ||    .:.
  Fly    73 DEYMMMFLRPTHYYPESALKRLKNFYHMKLKYGAACENIIPSKLRNVFEANI----LN----LLP 129

  Fly    99 NKDRDGKPLLILTIKKHSKSRNQE--DLLRILVFWI--ERLQRDSNLDKITIFMDMTGAGLSNLD 159
            .:|:.|:.||:|...|..|.....  ||.|.:...:  ..::..|.:....:.:||.|..||::.
  Fly   130 QRDQHGRRLLVLEAGKKWKPSQVPLVDLFRGIQLTVLGSMVEPYSQICGSVVIIDMEGLPLSHIT 194

  Fly   160 ----------MGFIKSII-----GVFETKYPYVPNYILVHDLPFLLDAAFKLV 197
                      :.:|:..|     .|......|:.|.:.....||:.:...|.:
  Fly   195 QFTPSFAAMLLDYIQECICMRLKAVHIVNNSYIFNMLFAVFKPFIREKLRKRI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 24/125 (19%)
CG5973NP_001162901.1 CRAL_TRIO_N 51..96 CDD:215024 5/22 (23%)
SEC14 116..272 CDD:238099 29/140 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.