DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG5958

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_609119.2 Gene:CG5958 / 34022 FlyBaseID:FBgn0031913 Length:294 Species:Drosophila melanogaster


Alignment Length:201 Identity:40/201 - (19%)
Similarity:83/201 - (41%) Gaps:15/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSF 75
            :..:||...:.:|.:...|.|    :| ...|.|.::|..|:...|..|..:.::....::||.:
  Fly    32 ETEEVKAEAIIKLRELLKATP----EL-NYKDDDAFLTVFLRACHFYPEGALEKMKTTASFRKEY 91

  Fly    76 G--VYDITEANLNQEFLNDGSIYV-HNKDRDGKPLLILTIKK--HSKSRNQEDLLRIL--VFWIE 133
            .  |..:....:.::|:....|.| .|.|:.|:.:||:...|  .......:::.|:|  |....
  Fly    92 ASLVRGLLVEQVKEKFVKGSVINVLKNCDQKGRRVLIVNCGKLWDPSDITSDEMFRMLYMVHLAA 156

  Fly   134 RLQRDSNLDKITIFMDMTGAGLSN---LDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFK 195
            :|:.::.:..:...||..|..:..   |...|.|.::...:...|.....:.....||:.:..:.
  Fly   157 QLEEETQVRGVVCIMDFEGLSMKQVKALSPSFSKRLLTFIQEAMPLRMKEVHFVKQPFIFNMVWS 221

  Fly   196 LVKTFL 201
            |.|.|:
  Fly   222 LFKPFV 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 24/118 (20%)
CG5958NP_609119.2 CRAL_TRIO_N 38..82 CDD:215024 10/48 (21%)
CRAL_TRIO 111..261 CDD:279044 24/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.