DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and AgaP_AGAP009311

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_559797.5 Gene:AgaP_AGAP009311 / 3291950 VectorBaseID:AGAP009311 Length:197 Species:Anopheles gambiae


Alignment Length:189 Identity:42/189 - (22%)
Similarity:73/189 - (38%) Gaps:44/189 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            |.|.|...|.:::..|.::.|..|          .||.|.  ::.|.|:...::|......:...
Mosquito    31 DPDRTSLMIEELRDMIYEKGECIP----------HRIDDD--YLVKFLRARFWNVHHAYNLMVRY 83

  Fly    69 LAWRKSFGVYDITEANLNQEF-----------LNDGSIYVHN--KDRDGKPLLILTIKKHSKSRN 120
            .|:|:|           |.||           |.|..|...:  :|::|:.::.....|...|:.
Mosquito    84 YAFRES-----------NPEFYENVNPMALRSLGDDDIISISPYRDQEGRRVICFKFGKWRPSKI 137

  Fly   121 Q-EDLLR--ILVFWIERLQRDSN-LDKITIFMDMTGAGLS---NLDMGFIKSIIGVFET 172
            . .||.|  :|:..:..|:..|. |..|.| ||:.|..|:   ||.....:.::.:..|
Mosquito   138 PIVDLFRATMLLLEVGSLEPQSQVLGGIGI-MDLEGLTLNHAWNLTPAVAQKMLALLAT 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 22/90 (24%)
AgaP_AGAP009311XP_559797.5 CRAL_TRIO_N 38..83 CDD:215024 10/56 (18%)
SEC14 105..>193 CDD:238099 22/88 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.