DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG31826

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001260473.1 Gene:CG31826 / 326164 FlyBaseID:FBgn0051826 Length:268 Species:Drosophila melanogaster


Alignment Length:215 Identity:46/215 - (21%)
Similarity:80/215 - (37%) Gaps:33/215 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLA 70
            |.|.|||.::: .:.|.:||        ..|| |:...|..:||.|....:|..|....:.|...
  Fly     9 DHTAEQIFKIE-QLRQLVEK--------CEDL-RVGTEDTLLTKFLHYTRWDTIKAYQAIHDYYE 63

  Fly    71 WRKSFGVYDITE--ANLNQEFLNDGSIYV-HNKDRDGKPLLILTIKKHSKSRNQEDLLRILV--- 129
            :::....:....  .:..|.|......|| ...||.|:.|::  .|.....::..|.|:.||   
  Fly    64 FKRRHPTWVARHPIEHYRQLFYGTHCRYVMPQADRSGRVLVV--FKTVDGFQDYPDYLQSLVEMD 126

  Fly   130 -------FWIERLQRDSNLDKITIFMDMTGAG---LSNLDMGFIKSIIGVFETKYPYVPNYILVH 184
                   ..:.|:|::.    ||:..|:.|..   |......|:| ::.......|:....:.:.
  Fly   127 DLIFESLLLLPRVQQNG----ITVICDLQGTNRNFLRQFSPAFMK-VVNEKNGVLPFSQRIVHII 186

  Fly   185 DLPFLLDAAFKLVKTFLPPE 204
            ...||:.....|...|:..|
  Fly   187 QRGFLMHVTSTLFMPFMNKE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 26/127 (20%)
CG31826NP_001260473.1 CRAL_TRIO_N 17..61 CDD:215024 12/53 (23%)
CRAL_TRIO 92..237 CDD:279044 25/122 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.