DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG3823

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_572313.1 Gene:CG3823 / 31573 FlyBaseID:FBgn0029863 Length:295 Species:Drosophila melanogaster


Alignment Length:216 Identity:44/216 - (20%)
Similarity:69/216 - (31%) Gaps:85/216 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDP---TPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLL--QVYDFDVEKCIT 63
            |:||   :.:|:.||...:        |.....|.:           .|||  ::.|||.:|.  
  Fly    73 DRDPLDASSQQLLQVADLV--------PLPGLTPEN-----------NKLLFYRLIDFDADKF-- 116

  Fly    64 RLWDNL--AWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLLR 126
                |.  |.:..|.|.|...|..|:|.|:||.|.|                             
  Fly   117 ----NFTAAIKVFFMVADCRFATENEERLSDGEIPV----------------------------- 148

  Fly   127 ILVFWIERLQRDSNLDKITIFMDMTGAGLSNLD---MGFIKSIIGVFETKYPYVPNYILVHDLPF 188
                                 .||.|..|.:|.   :|.::..:...:..:|.....|.|.:.|.
  Fly   149 ---------------------FDMAGYTLRHLTKTALGALRVYMKFVQEAHPVRLKEIHVLNCPS 192

  Fly   189 LLDAAFKLVKTFLPPEALKIL 209
            .:|....:||.|:..|..|::
  Fly   193 YVDKVMAVVKPFIKGEVFKLI 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 20/121 (17%)
CG3823NP_572313.1 SEC14 90..239 CDD:238099 38/199 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.