DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG3091

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001284816.1 Gene:CG3091 / 31210 FlyBaseID:FBgn0029608 Length:303 Species:Drosophila melanogaster


Alignment Length:265 Identity:53/265 - (20%)
Similarity:97/265 - (36%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQISQVKTSILQRLEKEP---PAEPFHPNDLKRITDSDLWITKLLQVYDFDVE--KCIT 63
            |:|..||..:...|....:|....   .|.|..|..::.|.     :.:.|:...||||  |.:.
  Fly     7 DKDSAPETSASPATGWSDKLTDLVAWFEANPNLPEKIEPIV-----MLRFLKCTAFDVERTKALA 66

  Fly    64 RLWDNLAWR-KSFGVYDITEANLNQEFLNDG-----SIYVHNKDRDGKPLLILTIKK-HSKSRNQ 121
            .|  |...| ||..::  .:.|:..|...:|     .:.:......|..|:...:.. ..::||.
  Fly    67 EL--NYCMRNKSPHLF--MDRNMEDEMTAEGLRVSDLLILPGVTPQGNKLIFFRMADLDPRTRNS 127

  Fly   122 EDLLRILVFW---------IERLQRDSNLDKITIFMDMTGAGLSNLDMG------------FIKS 165
            .:..:|.|..         :|| :..|..|.:....|:....:..:|:|            |:..
  Fly   128 VEETKIFVMMSDARFTKPDVER-ETGSGADYVLDEADIAEGDVQIVDIGGYTLRHLAYVSIFVLR 191

  Fly   166 IIGVF-ETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTK--KDIDQYVDKDNCL 227
            :...| :..||.....:.|.:.|..||....::..||..|...:::..|:  ..:.:.|.:|...
  Fly   192 VYMKFLQEAYPSRLQAMHVINCPTYLDKLISMMSPFLREEVRNMIRYHTEGMDSLYKEVPRDMLP 256

  Fly   228 KIWGG 232
            ..:||
  Fly   257 NEYGG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/171 (18%)
CG3091NP_001284816.1 SEC14 101..262 CDD:238099 29/162 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.