DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Vapa

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_017172989.1 Gene:Vapa / 30960 MGIID:1353561 Length:290 Species:Mus musculus


Alignment Length:54 Identity:12/54 - (22%)
Similarity:27/54 - (50%) Gaps:8/54 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QDPTPEQIS-QVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFD 57
            |:|:..::. :|||:..:|....|.:....|..:       :.::.:||.:|:|
Mouse    40 QNPSDRKVCFKVKTTAPRRYCVRPNSGIIDPGSI-------VTVSVMLQPFDYD 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044
VapaXP_017172989.1 Motile_Sperm 14..118 CDD:334183 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.