DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Ttpal

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001100007.1 Gene:Ttpal / 296349 RGDID:1305754 Length:343 Species:Rattus norvegicus


Alignment Length:296 Identity:49/296 - (16%)
Similarity:106/296 - (35%) Gaps:71/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPSDQDPTPEQISQVKTSILQRLEKEPPAEP-FHPNDLKRITD-------------SDLWITKLL 51
            :|......|..:..:...::.:..:|...:| :...|::.:.|             .|.::.:.|
  Rat    22 LPPPPPEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFL 86

  Fly    52 QVYDFDVEKCITRLWDNLAWRKSF-GVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKH 115
            :...||.::.:..|.:....|:|: .|:.....:..::.||.|               .||:..|
  Rat    87 RARKFDYDRALQLLVNYHGCRRSWPEVFSNLRPSALKDVLNSG---------------FLTVLPH 136

  Fly   116 SKSRNQEDL-----------------LRILVFWIERL--QRDSNLDKITIFMDMTGAGLSNLD-M 160
            :..|....|                 :|.:...:|:|  ..::.::.:.|..|..|..||... .
  Rat   137 TDPRGCHVLCIRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQVNGVVILADYKGVSLSKASHF 201

  Fly   161 G-FI-KSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALK--ILKVTTKKDIDQYV 221
            | || :.:||:.:..:|.....:.:.:.|.:....|.::|.||..:...  .|..:....:...:
  Rat   202 GPFIARKVIGILQDGFPIRIKAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLSSLHTSL 266

  Fly   222 DKDNCLKIWGG-----------------NDDYVYKF 240
            .::...|.:||                 .||:|.:|
  Rat   267 PRNILPKEYGGTAGELDTASWNAVLLASEDDFVKEF 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 29/181 (16%)
TtpalNP_001100007.1 CRAL_TRIO_N 57..103 CDD:215024 7/45 (16%)
SEC14 122..278 CDD:238099 30/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.