DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Rlbp1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001099744.1 Gene:Rlbp1 / 293049 RGDID:1309649 Length:317 Species:Rattus norvegicus


Alignment Length:148 Identity:30/148 - (20%)
Similarity:70/148 - (47%) Gaps:20/148 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NKDRDGKPLLILTIKK-HSKSRNQEDLLRILVFWIERL--QRDSNLDKITIFMDMTG------AG 154
            ::|:.|:.:::..|:. |.:....:::|:...|.:|:|  ..::.::...|..:..|      ||
  Rat   150 SRDKYGRVVMLFNIENWHCEEVTFDEILQAYCFILEKLLENEETQINGFCIVENFKGFTMQQAAG 214

  Fly   155 LSNLDMGFIKSIIGVFETKYPYVPNYILVHDL--PFLLDAAFKLVKTFLPPEALKILKVTTKKDI 217
            |...|   :|.::.:.:..:|  ..:..:|.:  |:.....:.:||.||..:.|:.:.| ...|:
  Rat   215 LRPSD---LKKMVDMLQDSFP--ARFKAIHFIHQPWYFTTTYNVVKPFLKNKLLQRVFV-HGDDL 273

  Fly   218 D---QYVDKDNCLKIWGG 232
            |   |.:|::.....:||
  Rat   274 DGFFQEIDENILPADFGG 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/148 (20%)
Rlbp1NP_001099744.1 CRAL_TRIO_N 60..117 CDD:215024
CRAL_TRIO 143..292 CDD:279044 30/148 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.