DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Sec14l5

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001129182.2 Gene:Sec14l5 / 287060 RGDID:1564638 Length:696 Species:Rattus norvegicus


Alignment Length:217 Identity:55/217 - (25%)
Similarity:92/217 - (42%) Gaps:32/217 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITE-----ANLNQEFLNDGSIYVHNKDRD 103
            |..|.:.|:..||.::|....|..:|:|||...|..:.:     |.| |||...|   .|.:|.|
  Rat   264 DEHILRFLRARDFHLDKARDMLCQSLSWRKQHQVDLLLQTWRPPAPL-QEFYAGG---WHYQDID 324

  Fly   104 GKPLLILTI-----KKHSKSRNQEDLLRILVFWIERLQR--DSN-------LDKITIFMDMTGAG 154
            |:||.||.:     |...|:..:|.||:.::...|..|:  :.|       :...|..:|:.|..
  Rat   325 GRPLYILRLGQMDTKGLMKAVGEEALLQHVLSVNEEGQKRCEGNTRQFGRPISSWTCLLDLEGLN 389

  Fly   155 LSNLDMGFIKSI---IGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKKD 216
            :.:|....:|::   |.|.|..||.....:|:...|.:....:.||..|:.....:...:.:..:
  Rat   390 MRHLWRPGVKALLRMIEVVEDNYPETLGRLLIVRAPRVFPVLWTLVSPFINENTRRKFLIYSGSN 454

  Fly   217 ------IDQYVDKDNCLKIWGG 232
                  :..|:|||......||
  Rat   455 YQGPGGLVDYLDKDVIPDFLGG 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 38/164 (23%)
Sec14l5NP_001129182.2 PRELI 17..173 CDD:309720
Amidase <179..309 CDD:327489 12/44 (27%)
CRAL_TRIO_N 243..288 CDD:215024 7/23 (30%)
CRAL_TRIO 314..477 CDD:306996 38/166 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.