DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and Ttpa

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_037180.1 Gene:Ttpa / 25571 RGDID:3915 Length:278 Species:Rattus norvegicus


Alignment Length:216 Identity:45/216 - (20%)
Similarity:86/216 - (39%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DQDPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            ::.|....:.|...:.|:|..:| ...|..|..|     :|.::.:.|:..|||::         
  Rat    15 NEQPDHSPLVQPGLAELRRRAQE-EGVPETPQPL-----TDAFLLRFLRARDFDLD--------- 64

  Fly    69 LAWR--KSFGVYDITEANLNQEFLNDGSI----------YVHNKDRDGKPLLILTIKK-HSKSRN 120
            ||||  |::..:......|:.: |:..||          .:.::|..|..:||..|.. ..|...
  Rat    65 LAWRLMKNYYKWRAECPELSAD-LHPRSILGLLKAGYHGVLRSRDPTGSRVLIYRISYWDPKVFT 128

  Fly   121 QEDLLRILVFWIERLQRDSNLDK--ITIFMDMTGAGLSN---LDMGFIKSIIGVFETKYPYVPNY 180
            ..|:.|:.:...|.:.::....:  :....|:.|..:|:   :.....|.|..|....:|.....
  Rat   129 AYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRG 193

  Fly   181 ILVHDLPFLLDAAFKLVKTFL 201
            |.:.:.|.:..|.|.::|.||
  Rat   194 IHLINEPVIFHAVFSMIKPFL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 25/126 (20%)
TtpaNP_037180.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 1/6 (17%)
CRAL_TRIO_N 25..73 CDD:215024 17/62 (27%)
CRAL_TRIO 99..248 CDD:395525 23/116 (20%)
Phosphatidylinositol 3,4-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 190..192 0/1 (0%)
Phosphatidylinositol 4,5-bisphosphate binding. /evidence=ECO:0000250|UniProtKB:Q8BWP5 208..211 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.