DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and SPAC3H8.02

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_592995.1 Gene:SPAC3H8.02 / 2543637 PomBaseID:SPAC3H8.02 Length:444 Species:Schizosaccharomyces pombe


Alignment Length:246 Identity:60/246 - (24%)
Similarity:112/246 - (45%) Gaps:21/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QVKTSILQRLEKEPPAEPFHPNDLK-------RITDSDLWITKLLQVYDFDVEKCITRLWDNLAW 71
            :.|...|:|:||  .|..:.|..|:       ...|.|..:.:.|:...::||..:......:.|
pombe    89 KTKNVHLERVEK--IASEWDPEGLRVCFWDAVNCDDPDGLLLRFLRARKWNVEAALEMFMKTVHW 151

  Fly    72 R-KSFGVYDIT----EANLNQEF---LNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLLRIL 128
            | :...|.:|.    ..:.:.:|   |..|..::..:|:..:|:..:..:.|.......:.:..|
pombe   152 RSREMNVGEIVCNADHLDKDDDFVRQLRIGKCFIFGEDKHNRPVCYIRARLHKVGDVSPESVERL 216

  Fly   129 VFWI---ERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLL 190
            ..|:   .||.....::..|:..|||...:||:|.|.:|.:|..||..||......:||..|:|.
pombe   217 TVWVMETARLILKPPIETATVVFDMTDFSMSNMDYGPLKFMIKCFEAHYPECLGECIVHKAPWLF 281

  Fly   191 DAAFKLVKTFLPPEALKILKVTTK-KDIDQYVDKDNCLKIWGGNDDYVYKF 240
            ...:.::|::|.|..:..:|.|.. :|:.||::.||.||.:||.:.:.|.:
pombe   282 QGVWSIIKSWLDPVVVSKVKFTRNYRDLQQYINPDNILKEFGGPNPWRYTY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 39/144 (27%)
SPAC3H8.02NP_592995.1 CRAL_TRIO_N <114..145 CDD:281722 5/30 (17%)
CRAL_TRIO 181..324 CDD:279044 38/142 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I1823
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - mtm9282
orthoMCL 1 0.900 - - OOG6_101230
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.