DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and CG30339

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_724813.1 Gene:CG30339 / 246549 FlyBaseID:FBgn0050339 Length:308 Species:Drosophila melanogaster


Alignment Length:260 Identity:59/260 - (22%)
Similarity:100/260 - (38%) Gaps:46/260 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITK---------------LLQVYDF 56
            |...::.::..:.|..:|:..||      |||.:.|   |:.|               .|:...|
  Fly     6 PLSAELRRIAETELNEVEERVPA------DLKALRD---WLAKQPHLRARQDDQFLVGFLRGCKF 61

  Fly    57 DVEKCITRLWDNLAWRKS-----FGVYDITEANLNQEFLNDGSIYVHNK---DRDGKPLLILTIK 113
            .:||..::| |:....|:     ||...:.|.||   .|.....||...   ..||..|.:...:
  Fly    62 SLEKTKSKL-DHFYTIKTLMPELFGKRLVDERNL---ILCRSGTYVRLPKPWGTDGPRLQLTNYE 122

  Fly   114 KHS-KSRNQEDLLRILVFWIERLQRD---SNLDKITIFMDMTGAGLS---NLDMGFIKSIIGVF- 170
            |.. |.....||.|......|:..|:   ||:......:||....||   .||...||. :|:| 
  Fly   123 KFDPKEFKLLDLFRYQTMITEQSIREDDHSNISGYVEIVDMAKMSLSFLAQLDFTLIKR-MGIFA 186

  Fly   171 ETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKV-TTKKDIDQYVDKDNCLKIWGGND 234
            |...|.....:.:.:.|....|...|.|:.:|.:..:...| ...:.:::.:.::...:.:|||:
  Fly   187 EKAQPTRLKGVHLINCPKEGVALLNLAKSLMPSKLQQRFHVYKNLEQLNEVIPREYLPEEYGGNN 251

  Fly   235  234
              Fly   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 33/152 (22%)
CG30339NP_724813.1 CRAL_TRIO_N 28..70 CDD:215024 11/50 (22%)
CRAL_TRIO 109..250 CDD:279044 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.