DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and ZC196.2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_505251.2 Gene:ZC196.2 / 191101 WormBaseID:WBGene00022546 Length:345 Species:Caenorhabditis elegans


Alignment Length:234 Identity:42/234 - (17%)
Similarity:84/234 - (35%) Gaps:46/234 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QVKTSILQRLEKEPPAEPFHPNDLKRIT----DSDLWITKLLQVYDFDVEKC---------ITRL 65
            :||||:.......|..:...|.:.::::    .||. ::...:.|...:|.|         :...
 Worm    43 KVKTSVPNMYVSRPNPDLLKPGEARQLSVKFRSSDK-VSLNAKSYKLKIESCEFESEDIDDLKSF 106

  Fly    66 WDNLAWRKSFGVYD---ITEANLNQEFLND--------GSIYVHNKDRDGKPLLILTIKKHSKSR 119
            |.::...|.. |:.   |.....:.:|.||        .|..:.|...|||.....|.|:..::.
 Worm   107 WSSIPNEKIL-VHKSPIILGTGSSPDFRNDQIASESSRQSSPIQNVSDDGKSSHHSTAKQLQENN 170

  Fly   120 NQEDLLRILVFWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVH 184
            .....|:.....:| :....|..     .|.||......| .|.|.  ...|.:..:|..   :|
 Worm   171 ENSKSLKYTKQLVE-VPLGENQQ-----ADQTGTTCDKKD-EFQKK--NQLEVEIKFVDK---IH 223

  Fly   185 DLPFLLDAAFKLVKTFLPPEALKILKVTTKKDIDQYVDK 223
            ::...|:.:|:|        .||.:::..::..::.:.:
 Worm   224 EIKSQLEDSFEL--------KLKEMEMRLEEKFEKRISR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 25/140 (18%)
ZC196.2NP_505251.2 Motile_Sperm 7..112 CDD:279029 12/69 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.