DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and R03A10.5

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_510554.2 Gene:R03A10.5 / 181634 WormBaseID:WBGene00010985 Length:382 Species:Caenorhabditis elegans


Alignment Length:260 Identity:52/260 - (20%)
Similarity:100/260 - (38%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 KEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEF 89
            ||...:|:   |||:       |.:|.::...|:.:.....::.|.|.:......|.|.....:|
 Worm     4 KENDIQPY---DLKK-------IQQLRELVKDDISEYYNTDFNILRWLQGHNTLPIEEIARKMKF 58

  Fly    90 -LNDGSIY----VHNKDRDGKPL-----------------LILTIKKHSKS-------------- 118
             ||..:.:    :|.|:|: .|:                 :|:.|::..|:              
 Worm    59 HLNLRAAWNLDELHKKERN-HPIHKHWKYGITGPSGHMDNVIVNIEQCGKTDYTGMMETYSILEV 122

  Fly   119 --RNQEDLLRILVFWIERLQRDSNLDKITIFMDMTG----AGLSNLDMGFIKSIIGVFETKYPYV 177
              ....||.::|...:|...:......|...||:||    ..|.:|..|.:||:.......|..:
 Worm   123 MRARMVDLEQMLHHVMELEAKTGKQAWILYVMDITGLQYNKKLYDLVTGSMKSLADFMADHYVEM 187

  Fly   178 PNYILVHDLPFLLDAAFKLVKTFLPP---EALKILKVTT-KKDIDQYVDKDNCLKIWGGNDDYVY 238
            ..|.:...:|....|.:.:|:..||.   |.::::..|. :.|:.||....:...|| .|:::.:
 Worm   188 IKYFVPVCVPSFATALYVVVRPLLPEKTREKVRLIGETNWRDDVLQYAIHSSLPSIW-NNENHTF 251

  Fly   239  238
             Worm   252  251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 35/185 (19%)
R03A10.5NP_510554.2 SEC14 77..249 CDD:214706 33/173 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.