Sequence 1: | NP_001261456.1 | Gene: | CG32407 / 38667 | FlyBaseID: | FBgn0052407 | Length: | 241 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510554.2 | Gene: | R03A10.5 / 181634 | WormBaseID: | WBGene00010985 | Length: | 382 | Species: | Caenorhabditis elegans |
Alignment Length: | 260 | Identity: | 52/260 - (20%) |
---|---|---|---|
Similarity: | 100/260 - (38%) | Gaps: | 58/260 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 KEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDITEANLNQEF 89
Fly 90 -LNDGSIY----VHNKDRDGKPL-----------------LILTIKKHSKS-------------- 118
Fly 119 --RNQEDLLRILVFWIERLQRDSNLDKITIFMDMTG----AGLSNLDMGFIKSIIGVFETKYPYV 177
Fly 178 PNYILVHDLPFLLDAAFKLVKTFLPP---EALKILKVTT-KKDIDQYVDKDNCLKIWGGNDDYVY 238
Fly 239 238 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32407 | NP_001261456.1 | CRAL_TRIO | 92..233 | CDD:279044 | 35/185 (19%) |
R03A10.5 | NP_510554.2 | SEC14 | 77..249 | CDD:214706 | 33/173 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1471 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1133487at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |