DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and cgr-1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_508618.2 Gene:cgr-1 / 180650 WormBaseID:WBGene00020847 Length:383 Species:Caenorhabditis elegans


Alignment Length:223 Identity:39/223 - (17%)
Similarity:89/223 - (39%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DSDLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGV------------YDITEANLNQEFLNDGS 94
            |:|..:.:.|..:|:.::..:.::...:....:.|:            .||...:...|:...| 
 Worm    39 DTDFSLLRWLMGWDYKIDVIVPKMRYAVETLVNLGMNNKQTTSVDQINRDIKNMSAVAEYFPGG- 102

  Fly    95 IYVHNKDRDGKPLLILTI-KKHSKSRNQ----EDLLRILV------FWIERLQRDSNLDK---IT 145
              :..|.:.|..:.:..: |.|.|:..:    ..|.::.:      |.|.| |.:...::   :.
 Worm   103 --IMGKSKRGDVVYMQAMAKAHPKTLVKAGPTSQLFQLCISETEMSFKIIR-QTEQETERKMGVI 164

  Fly   146 IFMDMTGAGLSNLDMGFIK---SIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPP---E 204
            |.||:.|..:..|....:|   |::.:.:..:|.....|.:.:.|.::.|.:.:|...|..   |
 Worm   165 IIMDLDGFSMDLLYTPTLKVYMSLLTMLQNIFPDFARRIYIINCPAMMSAVYAMVSPVLSSQTRE 229

  Fly   205 ALKILKVTTKKDIDQYVDKDNCLKIWGG 232
            .::.|....|..:.:.:.::|....|||
 Worm   230 KVRFLDKDWKNHLIEEIGEENIFMHWGG 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 31/161 (19%)
cgr-1NP_508618.2 SEC14 91..257 CDD:214706 30/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.