DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and hpo-28

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_498232.3 Gene:hpo-28 / 175798 WormBaseID:WBGene00015148 Length:567 Species:Caenorhabditis elegans


Alignment Length:246 Identity:74/246 - (30%)
Similarity:129/246 - (52%) Gaps:24/246 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPTP-EQISQVKTSILQRLEKEPPAEPFH-PNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDN 68
            |||. ..:.::::.|||    :|.....| .:|:.||...|.|:.:.|...::||:.....:.:.
 Worm    20 DPTNLLAVHELRSRILQ----DPAISVKHLSDDVHRIRHEDWWLDRFLGSVNYDVDIAYAIMLEC 80

  Fly    69 LAWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQED-LLRILVFWI 132
            |.||::|.|..|:..:| :..|::..:|:|.||...:.:|.:.:.|:   :|.:| ..::..|||
 Worm    81 LKWRRNFEVDRISLLSL-KPLLDNQLMYLHGKDLQNRHMLWIMMNKY---KNGDDGFEKLFTFWI 141

  Fly   133 ERLQRD-SNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPN---YILVHDLPFLLDAA 193
            ||...: .....:|:|:||||.||.|:....:|.||  ..:|| |.||   .||:.:.|.:|:|:
 Worm   142 ERHYMEYKGCQPLTVFIDMTGTGLKNMSFDAMKFII--HSSKY-YYPNSIESILIFENPAILNAS 203

  Fly   194 FKLVKTFLPPEALK----ILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            :|::.::|...|..    :|...||..:..||.|.:.|:..||.|  .:||
 Worm   204 WKVIGSWLESSAASQRHDLLTFVTKLSVTHYVPKSHLLEHQGGTD--TFKF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 46/149 (31%)
hpo-28NP_498232.3 SEC14 105..247 CDD:238099 46/147 (31%)
Motile_Sperm <381..460 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159698
Domainoid 1 1.000 79 1.000 Domainoid score I5614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm14425
orthoMCL 1 0.900 - - OOG6_101230
Panther 1 1.100 - - O PTHR46384
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.850

Return to query results.
Submit another query.