DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and C34C12.6

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_497717.2 Gene:C34C12.6 / 175452 WormBaseID:WBGene00007925 Length:400 Species:Caenorhabditis elegans


Alignment Length:260 Identity:49/260 - (18%)
Similarity:91/260 - (35%) Gaps:79/260 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPTPEQISQVKTSILQRLEKEPPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLA 70
            |....||:.|:..:.::|          |:.:....::||.:.:.::.|..|.||.:......||
 Worm    15 DSERSQINSVRAMLQEKL----------PDGIPDDVNTDLNLCRWIRGYHGDTEKLVKNFATYLA 69

  Fly    71 WRKSFGVY--DITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLLRILVF--- 130
            .||:.|..  |..|     :|....||         .|.|........:.|...|.....:|   
 Worm    70 SRKAAGFVGNDFAE-----KFFELPSI---------APFLQFIASSRLQDRQWSDEHNAFLFVER 120

  Fly   131 -W-----------------------------IERLQRDSNLDK-----ITIFMDMTGAGLSNLDM 160
             |                             |.|.::..:.||     |.|| |:....:::   
 Worm   121 AWSQPKEFIKTFKTSDYLLHCFGYSEMLQQLILRREKKQSADKGPVQFIVIF-DLNTVNITD--- 181

  Fly   161 GFIKSIIG----------VFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKILKVTTKK 215
             ::..:.|          :::..:|.:...|.:.:.|.||...:|:.:.||..|.||.:::.:.|
 Worm   182 -YVNPMSGYMKLWQIRSELWQDWFPEMVQRIYLTNPPRLLGLLWKVARVFLSEENLKRIEIISDK 245

  Fly   216  215
             Worm   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 29/172 (17%)
C34C12.6NP_497717.2 SEC14 91..265 CDD:214706 28/169 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.