DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and F18A11.2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_496771.1 Gene:F18A11.2 / 174945 WormBaseID:WBGene00008929 Length:388 Species:Caenorhabditis elegans


Alignment Length:233 Identity:46/233 - (19%)
Similarity:86/233 - (36%) Gaps:46/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 PNDLK-----RITDS-----------DLWITKLLQVYDFDVEKCITRLWDNLAWRKSFGVYDI-T 81
            ||.::     ||.||           :..:.:.|..|..:.|:....|..:|..||:..:... :
 Worm     3 PNPVEKAAILRIIDSIDARDDDYCAHEFNVYRWLVAYGNEEEEAAKALKRHLNIRKTIDLNSYSS 67

  Fly    82 EANLNQEFLNDGSIYV------HNKDRDGKPLLILTIKKHSKSRNQEDLLRILVFWIERLQRDSN 140
            :..|.::.||.   ||      .|...|.|.|:.....|...|...:::|......|:....:..
 Worm    68 KTELEEDELNK---YVPIDVIGQNHQDDNKVLMFERTGKIDISGLVDNVLMHKFMQIKLKMMEGV 129

  Fly   141 LDKITIFMDMTG---AGLSNLDMGFIK------SII--------GVFETKYPYVPNYILVHDLPF 188
            ..|:......||   .||..:|:..|.      |::        |.....||.:...|::.:.|.
 Worm   130 HQKVVAAERKTGRQSGGLFIMDLDGISFSPKLISVLTGPYRIMWGTLFDHYPQLLQKIIIVNAPS 194

  Fly   189 LLDAAFKLVKTFLPPEALKILKVTTKK---DIDQYVDK 223
            .::...:....|||.:..:.:.:|::.   .|.::.||
 Worm   195 FVNVLHQACSPFLPEDYKEKIVITSEPAIGAIQKHADK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/158 (19%)
F18A11.2NP_496771.1 SEC14 72..244 CDD:214706 32/164 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.