DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and ctg-2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001254156.1 Gene:ctg-2 / 174360 WormBaseID:WBGene00011756 Length:408 Species:Caenorhabditis elegans


Alignment Length:261 Identity:46/261 - (17%)
Similarity:99/261 - (37%) Gaps:54/261 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 QISQVKTSILQRLEKEPPAEPFHPN-DLKRITDSDLWITKLLQVYDFDVEKCITRLWDNLAWRKS 74
            :|::....:|..|.|.     .|.. :|.:..|.|..:.:.|..:|..::..:.::        .
 Worm    19 EITESDRKLLDELRKR-----IHKELELVKEYDDDFSLMRWLIGWDRKIDVVVPKI--------K 70

  Fly    75 FGVYDITEANLNQEFLNDGSIYVHNKDRDGKPL----------------LILTIKKH-------S 116
            |.:..|....|:||.|:.........|....||                :.|.:..|       .
 Worm    71 FSLRAIHALGLDQEDLSTLEKVAQKCDDCSVPLRYLPGSLIGLDHENNVVSLQMIGHLDAAGLMP 135

  Fly   117 KSRNQEDLLRI-------LVFWIERLQRDSN--LDKITIFMDMTGAGLSNLDMGFIK---SIIGV 169
            .:|| .||.|:       ::..|.:::::..  |....|| |:.|..:..:|:..:|   :::..
 Worm   136 ATRN-SDLYRMRIAESEGVMQIIRKMEKEQGKPLGTSVIF-DLDGLSMVQIDLAALKVVTTMLSQ 198

  Fly   170 FETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEA---LKILKVTTKKDIDQYVDKDNCLKIWG 231
            .:..:|.|...|.:.:.|..:...:.::...|..:.   :|||....|:.:.:.:.::...:.||
 Worm   199 LQEMFPDVIRKIFIVNTPTFIQVLWSMISPCLAKQTQQKVKILGNDWKQHLKENIGEEVLFERWG 263

  Fly   232 G 232
            |
 Worm   264 G 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 30/179 (17%)
ctg-2NP_001254156.1 SEC14 98..267 CDD:214706 29/169 (17%)
EMP24_GP25L 331..>405 CDD:279450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.