DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and ctg-1

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_491993.1 Gene:ctg-1 / 172431 WormBaseID:WBGene00010370 Length:383 Species:Caenorhabditis elegans


Alignment Length:159 Identity:31/159 - (19%)
Similarity:66/159 - (41%) Gaps:30/159 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DRDGKPLLILTIKKHSKSRNQEDLLR------ILVFWIERLQRDSNL------------DKITIF 147
            |.:|:|:|:..:    .:.:.|.|||      .:.|.:..:::...|            :::|:.
 Worm    88 DTEGRPILMSLL----GNVDVEGLLRSVASLDYIKFSLAAIEKGMKLCEEKAKESGRPFEQMTLV 148

  Fly   148 MDM---TGAGLSNLDM-GFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAFKLVKTFLPPEALKI 208
            .|:   |.|..|.... ....:::.:|:..||.....||:...|.:...|:..:...|.....::
 Worm   149 FDLENITSAHFSCKQFASSFTTLVSLFQDHYPLFLRKILIIRAPEMARIAYASITAILQDPITRL 213

  Fly   209 LKVTTKKD----IDQYVDKDNCLKIWGGN 233
            :::.::.|    :.|.|:.|.....||||
 Worm   214 VEMPSESDWKWSLAQIVNLDAWPMYWGGN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 29/157 (18%)
ctg-1NP_491993.1 SEC14 73..244 CDD:214706 31/159 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1133487at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.