DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32407 and MOSPD2

DIOPT Version :9

Sequence 1:NP_001261456.1 Gene:CG32407 / 38667 FlyBaseID:FBgn0052407 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_689794.1 Gene:MOSPD2 / 158747 HGNCID:28381 Length:518 Species:Homo sapiens


Alignment Length:241 Identity:73/241 - (30%)
Similarity:135/241 - (56%) Gaps:12/241 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EQISQVKTSIL----QRLEKE---PPAEPFHPNDLKRITDSDLWITKLLQVYDFDVEKCITRLWD 67
            |..:|.|..::    :|.|.|   ..::.:...|::|:...|.|:...|......|::.:..|.:
Human     3 ENHAQNKAKLISETRRRFEAEYVTDKSDKYDARDVERLQQDDNWVESYLSWRHNIVDETLKMLDE 67

  Fly    68 NLAWRKSFGVYDITEANLNQEFLNDGSIYVHNKDRDGKPLLILTIKKHSKSRNQEDLL---RILV 129
            :..|||...|.|:.|:::.:..|..|.||:|..|::|..|..:.:|.|.|  :|:.:|   :::.
Human    68 SFQWRKEISVNDLNESSIPRWLLEIGVIYLHGYDKEGNKLFWIRVKYHVK--DQKTILDKKKLIA 130

  Fly   130 FWIERLQRDSNLDKITIFMDMTGAGLSNLDMGFIKSIIGVFETKYPYVPNYILVHDLPFLLDAAF 194
            ||:||..:..|...:|:..|::..|::::||.|::.||..|:..||...:.|::.|:|:|::|||
Human   131 FWLERYAKRENGKPVTVMFDLSETGINSIDMDFVRFIINCFKVYYPKYLSKIVIFDMPWLMNAAF 195

  Fly   195 KLVKTFLPPEALKILKVTTKKDIDQYVDKDNCLKIWGGNDDYVYKF 240
            |:|||:|.|||:.:||.|:|.::..||..:......||.|.:.|.:
Human   196 KIVKTWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32407NP_001261456.1 CRAL_TRIO 92..233 CDD:279044 50/143 (35%)
MOSPD2NP_689794.1 CRAL_TRIO 93..234 CDD:279044 50/142 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 252..308
Motile_Sperm 327..431 CDD:279029
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147719
Domainoid 1 1.000 109 1.000 Domainoid score I6349
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D217631at33208
OrthoFinder 1 1.000 - - FOG0002427
OrthoInspector 1 1.000 - - otm40598
orthoMCL 1 0.900 - - OOG6_101230
Panther 1 1.100 - - O PTHR46384
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1928
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.